PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BS_282C4747C.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 1431aa    MW: 154545 Da    PI: 6.4905
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BS_282C4747C.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.95.3e-09445487347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            +WT eE e + +  + +G++ +++I++ ++ ++t  +c+++++k+
  Traes_1BS_282C4747C.2 445 PWTHEEKEVFMQMLASFGKN-FSKISNFLQ-HKTTADCVEFYYKH 487
                            8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-14428490IPR009057Homeodomain-like
PROSITE profilePS5129314.727441492IPR017884SANT domain
SMARTSM007172.2E-8442490IPR001005SANT/Myb domain
PfamPF002491.3E-6444487IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-7444489IPR009057Homeodomain-like
PROSITE profilePS5129314.846652703IPR017884SANT domain
SMARTSM007176.9E-5653701IPR001005SANT/Myb domain
PfamPF002492.0E-5656696IPR001005SANT/Myb domain
SuperFamilySSF466891.56E-8656698IPR009057Homeodomain-like
CDDcd001674.41E-4657695No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1431 aa     Download sequence    Send to blast
MSSKDIPGAE VQAYNDEIPI KLGQLDGDRI GSLANVLAEL LQHEDSCSGD SRRLTNSSKL  60
LLLKENIARE LEKTELEIDS LECELKSVST ESENKALEDA ENPSPSSGTS KILAKPATSK  120
VLAKPETSKV LAKPEICGTS SSPKEQGVLT PCKLPVEQEA DANGVDLMDV VTAPVRSVTA  180
VSSGESVACP GVVAEAEVAV AADVAPLKPS EGTGSQIDAH CPRQEPSLSH DNVSSMKADG  240
SNALSTRQCS HRIDSRNLIP SIIAVNNDIA KEFNELVFKP LPAGQPCLGL SSQMKNDLSV  300
RKKLGIHKNR LRFKEQALTF KFKVLRHLWK EDVRLLSVRK QRPKSNKRTD QSNRASQSGS  360
QRQRSSIRSR LGMPAGNLST FPTTEISDVA NKMFTEFQFK RCRNYLKMPA LIIDEKEKES  420
ASFVSKNGLI EDPVSVEKER SVINPWTHEE KEVFMQMLAS FGKNFSKISN FLQHKTTADC  480
VEFYYKHHKS DSFREVKKLL DLRQQQPTGN YLGTKSGKKW NPENAASLDM LGNAASVVAA  540
HGLDYANRVE RDTEKSIIRT SCKSDVSAVA KGSLDKDGIA NVSLHERESV AADVLAGICG  600
TLSPEGMGSC ITSSADHGQK IGATRMEYLI ATPEADKSFD EEDDLSDQEC EVDSVDWNDN  660
EKSLFIEALN NHGKDFARIS SYVKSKSYEQ CKVFFSKARI SLGLDLIYQQ TTDTGLPTGD  720
ASGGRSDTDE ACAAEMDSPI CSTQSPVEME MEVCPSADKT LQGHLLSGIT FKQSETDRSD  780
GPEIVDLTIE EGEIKADDTN NCNIPVDHRQ SSEATHQSTP SCAPIDINSS ESTGSMENRE  840
HSNQVSVHGN GAMASSTEQP VGAHLEISSS LHIVEVIEPS KASEKICIQV STREHAPESG  900
APISAGNLTT PVFLPGVIQS SNVYEGICTK ESSVEGPSQQ APLSAHMKAG NLTLSVCLPG  960
EHCSKVSSNE GPSKHAPESA HVKAGNSTPS VCLPGESGSK ENVAHFSDMA GVSCIRPAFT  1020
LSYQQSVPTD LLPAKPKSQV TPLTPKDLMP VQFSSDLPDP TSIRFEGIAS ITSPNFGDHA  1080
NRVSNTPGPK DMSKFPVFNE QSRSQHDVLF RNIDGYLQHR RNHHLAVDIP AFSDSTVSGS  1140
VGISHPDQFT ITKYQNGRSG SSGLSSTSAG FLMNGSSKEL REGQLKPCSH KASTESCDQV  1200
KRPGDVKLFG KILSHQSSLQ SSGSSSNVTR SKPPPPTTAA GLLGSGMDRM VYSSRPTNTA  1260
HFGQDERVVR SYTHLDGSTV QPESSLFRVA KCQRSSLASV PFYSAKNGTL GVLAEYQQPL  1320
RQQLPSDPKR LESYADLQKR NGIELISGFQ QQQPGKAARL GGAGILVSPV SDPVAALKAQ  1380
YGSSSKFLGK DADHPWKDIG NRKMQIAYLA VMLDMSIIGC GPRGGRTPHA M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C6e-16403494494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D6e-16403494494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLW5A8F90.0W5A8F9_WHEAT; Uncharacterized protein
STRINGSi020953m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-70MYB family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]